Structure of PDB 6zzy Chain G

Receptor sequence

>6zzyG (length=99) Species: 2649997 (Chlorella ohadii) [Search protein sequence]

LADVNLVVGGCTVGALALGRFVFLPFHRASLAKAGMPKQNGMTHLQAGDA
RAEEASFILKTNDPAGFTVVDVMAWGALGHAAAFYILATSSLGLDRNPF

3D structure

PDB

6zzy Cryo-EM photosystem I structure reveals adaptation mechanisms to extreme high light in Chlorella ohadii.

Chain

Resolution

3.16 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	G	R1278 F1284	R51 F57
BS02	CLA	G	Y1312 A1315 T1316 L1319	Y85 A88 T89 L92
BS03	CLA	G	V1297 M1300 A1301	V70 M73 A74
BS04	CLA	G	F1250 F1253 H1254 S1257 L1258	F23 F26 H27 S30 L31
BS05	CLA	G	N1232 V1235 G1236 V1240 H1307 F1311	N5 V8 G9 V13 H80 F84
BS06	CLA	G	R1247 F1248 T1288 N1289 D1290 P1291 F1294 V1299	R20 F21 T61 N62 D63 P64 F67 V72
BS07	CLA	G	T1316 R1323 N1324 P1325 F1326	T89 R96 N97 P98 F99
BS08	ERG	G	Y1312 T1316	Y85 T89

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009535	chloroplast thylakoid membrane
GO:0016020	membrane

External links