Structure of PDB 6zxs Chain G

Receptor sequence
>6zxsG (length=97) Species: 3888 (Pisum sativum) [Search protein sequence]
LNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDTR
AKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKF
3D structure
PDB6zxs Structure of cold grown pea Photosystem I
ChainG
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G D105 R107 Y111 D48 R50 Y54
BS02 CLA G F79 F82 Q83 N86 V87 Q90 F22 F25 Q26 N29 V30 Q33
BS03 CLA G S61 I64 S65 T68 G69 H136 Y140 S4 I7 S8 T11 G12 H79 Y83
BS04 CLA G R76 F77 S117 N118 D119 P120 I125 R19 F20 S60 N61 D62 P63 I68
BS05 CLA G Y141 T145 N148 Y150 Y84 T88 N91 Y93
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 01:36:25 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zxs', asym_id = 'G', title = 'Structure of cold grown pea Photosystem I'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zxs', asym_id='G', title='Structure of cold grown pea Photosystem I')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009522,0009535,0015979,0016020', uniprot = '', pdbid = '6zxs', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0009535,0015979,0016020', uniprot='', pdbid='6zxs', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>