Structure of PDB 6zoo Chain G

Receptor sequence
>6zooG (length=97) Species: 3888 (Pisum sativum) [Search protein sequence]
LNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDTR
AKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKF
3D structure
PDB6zoo Structure of plant photosystem I-plastocyanin complex reveals strong hydrophobic interactions.
ChainG
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G R107 Y111 R50 Y54
BS02 CLA G Y141 N148 Y84 N91
BS03 CLA G F79 F82 N86 V87 Q90 F22 F25 N29 V30 Q33
BS04 CLA G Q90 I137 Q33 I80
BS05 CLA G S61 I64 S65 S4 I7 S8
BS06 CLA G R76 F77 N118 D119 F123 I125 R19 F20 N61 D62 F66 I68
BS07 CLA G Y141 T145 N148 Y150 P152 Y84 T88 N91 Y93 P95
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zoo, PDBe:6zoo, PDBj:6zoo
PDBsum6zoo
PubMed34085703
UniProtA0A0M3KL13

[Back to BioLiP]