Structure of PDB 6zhx Chain G

Receptor sequence
>6zhxG (length=110) Species: 8355 (Xenopus laevis) [Search protein sequence]
TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLP
NIQSVLLPKK
3D structure
PDB6zhx Mechanistic Insights into Regulation of the ALC1 Remodeler by the Nucleosome Acidic Patch.
ChainG
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R11 R29 R42 V43 G44 A45 K75 T76 R77 R2 R20 R33 V34 G35 A36 K66 T67 R68
BS02 dna G R11 A14 K15 R17 R20 R32 R77 R2 A5 K6 R8 R11 R23 R68
BS03 peptide G Y57 E61 E64 D90 E92 Y48 E52 E55 D81 E83
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6zhx, PDBe:6zhx, PDBj:6zhx
PDBsum6zhx
PubMed33357431
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]