Structure of PDB 6zga Chain G

Receptor sequence
>6zgaG (length=167) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
HGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTF
DLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAEL
KDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGSQRIEGQRPVEVFMCS
VVMRNGYLEAFQWLSQY
3D structure
PDB6zga Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
ChainG
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP G N33 G35 K36 T37 T38 Q52 P53 T54 K133 D135 V174 N11 G13 K14 T15 T16 Q30 P31 T32 K111 D113 V152
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
Biological Process
GO:0000266 mitochondrial fission
GO:0003400 regulation of COPII vesicle coating
GO:0006886 intracellular protein transport
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006998 nuclear envelope organization
GO:0007006 mitochondrial membrane organization
GO:0015031 protein transport
GO:0016050 vesicle organization
GO:0016192 vesicle-mediated transport
GO:0061024 membrane organization
GO:0070863 positive regulation of protein exit from endoplasmic reticulum
GO:1902953 positive regulation of ER to Golgi vesicle-mediated transport
Cellular Component
GO:0000139 Golgi membrane
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0012507 ER to Golgi transport vesicle membrane
GO:0016020 membrane
GO:0030127 COPII vesicle coat
GO:0031410 cytoplasmic vesicle
GO:0044233 mitochondria-associated endoplasmic reticulum membrane contact site
GO:0070971 endoplasmic reticulum exit site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zga, PDBe:6zga, PDBj:6zga
PDBsum6zga
PubMed33795673
UniProtP20606|SAR1_YEAST Small COPII coat GTPase SAR1 (Gene Name=SAR1)

[Back to BioLiP]