Structure of PDB 6yur Chain G

Receptor sequence

>6yurG (length=254) Species: 1280 (Staphylococcus aureus)

NLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLL
EQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDL
RGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEF
AVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVG
GFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGF
HAIK

3D structure

• PDB: 6yur A Long Residence Time Enoyl-Reductase Inhibitor Explores an Extended Binding Region with Isoenzyme-Dependent Tautomer Adaptation and Differential Substrate-Binding Loop Closure.
• Chain: G
• Resolution: 1.96 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y157 K164
• Catalytic site (residue number reindexed from 1): Y155 K162
• Enzyme Commision number: 1.3.1.39: enoyl-[acyl-carrier-protein] reductase (NADPH, Re-specific).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	G	G13 A15 S19 I20 R40 K41 S44 D66 V67 S93 I94 A95 I120 T145 T146 Y147 K164 A190 P192 I193 T195 S197	G11 A13 S17 I18 R38 K39 S42 D64 V65 S91 I92 A93 I118 T143 T144 Y145 K162 A188 P190 I191 T193 S195
BS02	F9T	G	F96 A97 M99 Y147 Y157 M160 S197 V201	F94 A95 M97 Y145 Y155 M158 S195 V199

Gene Ontology

Molecular Function

• GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding
• GO:0050661 NADP binding
• GO:0141148 enoyl-[acyl-carrier-protein] reductase (NADPH) activity

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0030497 fatty acid elongation

External links

• PDB: RCSB:6yur, PDBe:6yur, PDBj:6yur
• PDBsum: 6yur
• PubMed: 33710875
• UniProt: Q2FZQ3|FABI_STAA8 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI (Gene Name=fabI)