Structure of PDB 6ylx Chain G

Receptor sequence

>6ylxG (length=192) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

RNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYTLDRNTAAETFKL
FNKYRPETAAEKKERLTKEAAAVAEGKSKQDASPKPYAVKYGLNHVVALI
ENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIVKGKARLGTLVNQK
TSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGG

3D structure

PDB

6ylx Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.

Chain

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	G	K51 E54 Y55 E100 K105 R108 Q123 S126 P127 K128 P129 K133 Y134 G135 L136 N137 H138 A141 L142 V157 D158 P159 L162 K193 S195	K8 E11 Y12 E57 K62 R65 Q80 S83 P84 K85 P86 K90 Y91 G92 L93 N94 H95 A98 L99 V114 D115 P116 L119 K150 S152
BS02	rna	G	Y55 Q59 R60 D156 K181 R185	Y12 Q16 R17 D113 K138 R142
BS03	rna	G	N85 K92 K213 S216	N42 K49 K170 S173

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ylx, PDBe:6ylx, PDBj:6ylx
PDBsum	6ylx
PubMed	32668200
UniProt	P17076\|RL8A_YEAST Large ribosomal subunit protein eL8A (Gene Name=RPL8A)

[Back to BioLiP]