Structure of PDB 6yef Chain G

Receptor sequence
>6yefG (length=154) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
LKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNA
VEELELITGQKPLVTKATFRLREGMPIGAKVTLRGERMYEFLDKLISVSL
PRVRDFQGVSKKAFDGRGNYTLGVKEQDKVSKVRGMDIVIVTTANTDEEA
RELL
3D structure
PDB6yef Cryo-EM structure of the ribosome functional complex of the human pathogen Staphylococcus aureus at 3.2 angstrom resolution.
ChainG
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G K33 V35 N37 G39 P65 V67 T68 F77 I85 K88 A121 F122 D123 R125 N127 T129 V132 D144 K145 V149 K30 V32 N34 G36 P62 V64 T65 F69 I77 K80 A113 F114 D115 R117 N119 T121 V124 D128 K129 V133
BS02 rna G S24 M26 E27 T61 Q63 T90 R92 S21 M23 E24 T58 Q60 T82 R84
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yef, PDBe:6yef, PDBj:6yef
PDBsum6yef
PubMed32852796
UniProtQ2FW18|RL5_STAA8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]