Structure of PDB 6yal Chain G

Receptor sequence

>6yalG (length=263) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

MARGPKKHLKRVAAPKHWMLDKLTSVFAPRPSTGPHKLRECLPLIIFLRN
KLKYALTGDEVKKICMQRFIKIDGKVRADITYPAGFMDVISIDKTGENFR
LIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYP
DPLIKMNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRER
HPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAE
ERDKRLAAKQSSG

3D structure

PDB

6yal Structural Insights into the Mammalian Late-Stage Initiation Complexes.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	M1 A2 R3 G4 K6 K7 H8 K10 V12 K16 M19 K22 L23 S25 F27 P29 R30 T33 G34 R49 T57 K62 K63 M66 Q67 K75 R77 R108 K128 V131 G132 K134 A144 T146 R148 K155 G186 A187 A219 R221 Q260 S261 S262 G263	M1 A2 R3 G4 K6 K7 H8 K10 V12 K16 M19 K22 L23 S25 F27 P29 R30 T33 G34 R49 T57 K62 K63 M66 Q67 K75 R77 R108 K128 V131 G132 K134 A144 T146 R148 K155 G186 A187 A219 R221 Q260 S261 S262 G263

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6yal, PDBe:6yal, PDBj:6yal
PDBsum	6yal
PubMed
UniProt	G1TK17\|RS4X_RABIT Small ribosomal subunit protein eS4 (Gene Name=RPS4X)

[Back to BioLiP]