Structure of PDB 6xl6 Chain G

Receptor sequence
>6xl6G (length=268) Species: 562 (Escherichia coli) [Search protein sequence]
SQIGLFSKICRVTIKTLHYYNKIGLLVPAYINPDNGYRFYTSDQLMKFHQ
IASLRQLGFTITEIVTLTQDENSCHIIERRRLEIQKQIRDMADMLSRINH
YLQHKKKERIMLYQAALKEIPECIVYSKRFIVPDFSSYIKLIPPIGQEVM
KANPGLTLTTPAYCFTLYHDKEYKEKNMDVEFCEAVNDFGKNEGNIIFQV
IPAITAVTVIHKGPYDSLRNAYIYLMQWVEDNGYLLTNSPRESYIDGIWN
KQDSAEWMTEIQFPVEKV
3D structure
PDB6xl6 Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.
ChainG
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G T14 K16 T17 Y20 Y21 R56 T61 I62 T13 K15 T16 Y19 Y20 R55 T60 I61
BS02 dna G Q3 I4 G5 H19 G37 Y38 R39 Q2 I3 G4 H18 G36 Y37 R38
BS03 1N7 G Y169 E173 Y174 E176 R220 Y223 M227 Y168 E172 Y173 E175 R219 Y222 M226
BS04 118 G Y127 I143 G147 C165 E185 W250 Y126 I142 G146 C164 E184 W249
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 04:53:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6xl6', asym_id = 'G', title = 'Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6xl6', asym_id='G', title='Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0003700,0006355', uniprot = '', pdbid = '6xl6', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003700,0006355', uniprot='', pdbid='6xl6', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>