Structure of PDB 6xh8 Chain G

Receptor sequence
>6xh8G (length=130) Species: 562 (Escherichia coli) [Search protein sequence]
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLL
RQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQS
MRDQLLALANACPGDDSADCPIIENLSGCC
3D structure
PDB6xh8 Structural basis of copper-efflux-regulator-dependent transcription activation.
ChainG
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G K15 F19 Y20 L60 K15 F19 Y20 L60
BS02 dna G N2 S4 R31 G35 Y36 R37 N2 S4 R31 G35 Y36 R37
BS03 CU G C120 P121 C120 P121
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005507 copper ion binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xh8, PDBe:6xh8, PDBj:6xh8
PDBsum6xh8
PubMed34113812
UniProtP0A9G4|CUER_ECOLI HTH-type transcriptional regulator CueR (Gene Name=cueR)

[Back to BioLiP]