Structure of PDB 6x5a Chain G

Receptor sequence
>6x5aG (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLL
3D structure
PDB6x5a The molecular basis of tight nuclear tethering and inactivation of cGAS.
ChainG
Resolution4.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R11 K13 R29 R42 V43 G44 A45 T76 R77 R2 K4 R20 R33 V34 G35 A36 T67 R68
BS02 dna G A12 K15 R17 R20 R29 R32 R42 A3 K6 R8 R11 R20 R23 R33
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6x5a, PDBe:6x5a, PDBj:6x5a
PDBsum6x5a
PubMed32911481
UniProtP0C0S8|H2A1_HUMAN Histone H2A type 1 (Gene Name=H2AC11)

[Back to BioLiP]