Structure of PDB 6ua2 Chain G

Receptor sequence

>6ua2G (length=488) Species: 9606 (Homo sapiens) [Search protein sequence]

SYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKY
EQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISS
RDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLP
IVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRL
DLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQA
KNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKK
YRGMGSLDAMIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSL
TQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

3D structure

PDB

6ua2 Cryo-EM structures demonstrate human IMPDH2 filament assembly tunes allosteric regulation.

Chain

Resolution

4.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.1.1.205: IMP dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	G	K57 T60 R355 R356 T477 R480	K47 T50 R345 R346 T451 R454
BS02	ATP	G	R161 R224	R151 R214
BS03	ATP	G	I157 S159 S160 R161 D162 L185 V186 K206 G207 K208 P210 R224	I147 S149 S150 R151 D152 L175 V176 K196 G197 K198 P200 R214
BS04	ATP	G	I115 V119 F139 C140 G141 K208 A223 R224 T225	I105 V109 F129 C130 G131 K198 A213 R214 T215
BS05	IMP	G	R322 G328 S329 I330 C331 D364 G365 G366 M385 G387 S388 G413 M414 G415 Q441	R312 G318 S319 I320 C321 D354 G355 G356 M375 G377 S378 G403 M404 G405 Q415
BS06	NAD	G	T252 H253 D274 S275 S276 F282 N303 M325 M414	T242 H243 D264 S265 S266 F272 N293 M315 M404

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003824	catalytic activity
GO:0003938	IMP dehydrogenase activity
GO:0005515	protein binding
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006164	purine nucleotide biosynthetic process
GO:0006177	GMP biosynthetic process
GO:0006183	GTP biosynthetic process
GO:0007623	circadian rhythm
GO:0046651	lymphocyte proliferation
GO:0071353	cellular response to interleukin-4
GO:0097294	'de novo' XMP biosynthetic process

	Cellular Component
GO:0005576	extracellular region
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005778	peroxisomal membrane
GO:0005829	cytosol
GO:0016020	membrane
GO:0034774	secretory granule lumen
GO:0070062	extracellular exosome
GO:1904813	ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ua2, PDBe:6ua2, PDBj:6ua2
PDBsum	6ua2
PubMed	31999252
UniProt	P12268\|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 (Gene Name=IMPDH2)

[Back to BioLiP]