Structure of PDB 6tb3 Chain G

Receptor sequence
>6tb3G (length=121) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIA
GYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLSRLNVDNQ
TSDLVKSLGLKLPLSVINVSA
3D structure
PDB6tb3 The Ccr4-Not complex monitors the translating ribosome for codon optimality.
ChainG
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G G2 R3 V4 R5 T6 K7 K10 F28 K32 S43 K44 R45 N48 K49 H56 K59 R60 R67 G1 R2 V3 R4 T5 K6 K9 F27 K31 S42 K43 R44 N47 K48 H55 K58 R59 R66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tb3, PDBe:6tb3, PDBj:6tb3
PDBsum6tb3
PubMed32299921
UniProtP14127|RS17B_YEAST Small ribosomal subunit protein eS17B (Gene Name=RPS17B)

[Back to BioLiP]