Structure of PDB 6suw Chain G |
>6suwG (length=90) Species: 269796 (Rhodospirillum rubrum ATCC 11170) [Search protein sequence] |
STHEPLEVLKEETVNRHRAIVSVMAELEAVDWYDQRVDASTDPELTAILA HNRDEEKEHAAMTLEWLRRNDAKWAEHLRTYLFTEGPITA |
|
PDB | 6suw Dissecting the structural and functional roles of a putative metal entry site in encapsulated ferritins. |
Chain | G |
Resolution | 2.66 Å |
3D structure |
|
|
Enzyme Commision number |
1.16.3.1: ferroxidase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
G |
E32 E62 H65 |
E26 E56 H59 |
|
|
|
|