Structure of PDB 6sl5 Chain G

Receptor sequence

>6sl5G (length=101) Species: 3046 (Dunaliella salina)

LEPAVAIGGSTVSFLALGRFVFLPYQRRRTEMEVGPGRLGPKTTGDTFFD
RLQKPASFVETKSKDPSGFGGWHAALGHVFGYFLLACSSLQDAGQVIAHW
G

3D structure

• PDB: 6sl5 Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.
• Chain: G
• Resolution: 2.84 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	G	F107 L111 C114 S116 L117	F80 L84 C87 S89 L90
BS02	CLA	G	F49 Y52 Q53 R56 T57 E60	F22 Y25 Q26 R29 T30 E33
BS03	CLA	G	A43 R46 F47 T88 K89	A16 R19 F20 T61 K62

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 20:49:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6sl5', asym_id = 'G', title = 'Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6sl5', asym_id='G', title='Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009522,0015979', uniprot = '', pdbid = '6sl5', asym_id = 'G'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0015979', uniprot='', pdbid='6sl5', asym_id='G')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>