Structure of PDB 6se6 Chain G

Receptor sequence
>6se6G (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]
ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLP
3D structure
PDB6se6 CENP-C unwraps the human CENP-A nucleosome through the H2A C-terminal tail.
ChainG
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G K13 R29 R42 V43 A45 T76 R77 K4 R20 R33 V34 A36 T67 R68
BS02 dna G R11 K15 R17 R32 R77 R2 K6 R8 R23 R68
BS03 peptide G E61 N89 E91 E92 E52 N80 E82 E83
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6se6, PDBe:6se6, PDBj:6se6
PDBsum6se6
PubMed31475439
UniProtQ6FI13|H2A2A_HUMAN Histone H2A type 2-A (Gene Name=H2AC18)

[Back to BioLiP]