Structure of PDB 6ro4 Chain G

Receptor sequence

>6ro4G (length=134) Species: 9606 (Homo sapiens) [Search protein sequence]

ICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDC
DLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEA
KEVRQENREKMKQKKFDKKVKELRRAVRSSVWKR

3D structure

PDB

6ro4 Structural basis of TFIIH activation for nucleotide excision repair.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	G	T142 N169 H171 H172 M178 K179	T39 N66 H68 H69 M75 K76
BS02	dna	G	W175 R207 R211	W72 R104 R108
BS03	ZN	G	C108 C126	C5 C23

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003684	damaged DNA binding
GO:0005515	protein binding
GO:0019904	protein domain specific binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:1990837	sequence-specific double-stranded DNA binding

	Biological Process
GO:0000715	nucleotide-excision repair, DNA damage recognition
GO:0006281	DNA repair
GO:0006284	base-excision repair
GO:0006289	nucleotide-excision repair
GO:0009650	UV protection
GO:0010996	response to auditory stimulus
GO:0034504	protein localization to nucleus
GO:0070914	UV-damage excision repair
GO:1901255	nucleotide-excision repair involved in interstrand cross-link repair

	Cellular Component
GO:0000110	nucleotide-excision repair factor 1 complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005662	DNA replication factor A complex
GO:0045171	intercellular bridge

External links

PDB	RCSB:6ro4, PDBe:6ro4, PDBj:6ro4
PDBsum	6ro4
PubMed	31253769
UniProt	P23025\|XPA_HUMAN DNA repair protein complementing XP-A cells (Gene Name=XPA)