Structure of PDB 6rke Chain G

Receptor sequence

>6rkeG (length=272) Species: 322710 (Azotobacter vinelandii DJ) [Search protein sequence]

TNSIKHVISPLARQTLQDRDLTRPVAGKRPIRLLPWLQVVKIGGRVMDRG
ADAILPLVEELRKLLPEHRLLILTGAGVRARHVFSVGLDLGLPVGSLAPL
AASEAGQNGHILAAMLASEGVSYVEHPTVADQLAIHLSATRAVVGSAFPP
YHHHEFPGSRIPPHRADTGAFLLADAFGAAGLTIVENVDGIYTADPNGPD
RGQARFLPETSATDLAKSEGPLPVDRALLDVMATARHIERVQVVNGLVPG
RLTAALRGEHVGTLIRTGVRPA

3D structure

PDB

6rke Molybdate pumping into the molybdenum storage protein via an ATP-powered piercing mechanism.

Chain

Resolution

1.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	8M0	G	H156 H157 H158	H152 H153 H154
BS02	ATP	G	K45 G47 G48 R49 A80 E190 N191 V192 Y196 D199 P200 N201 P225 L226 P227	K41 G43 G44 R45 A76 E186 N187 V188 Y192 D195 P196 N197 P221 L222 P223
BS03	MG	G	E190 P227	E186 P223
BS04	8M0	G	P103 A106 S107 G110 Q111 H114 Y127 E129 H130 P131 S150 P154 H156	P99 A102 S103 G106 Q107 H110 Y123 E125 H126 P127 S146 P150 H152
BS05	LHW	G	E129 P131 T132 Q136	E125 P127 T128 Q132

Gene Ontology

	Molecular Function
GO:0030151	molybdenum ion binding
GO:0045735	nutrient reservoir activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6rke, PDBe:6rke, PDBj:6rke
PDBsum	6rke
PubMed	31811022
UniProt	P84308\|MOSA_AZOVD Molybdenum storage protein subunit alpha (Gene Name=mosA)

[Back to BioLiP]