Structure of PDB 6qgr Chain G

Receptor sequence

>6qgrG (length=253) Species: 1434108 (Methanosarcina barkeri MS) [Search protein sequence]

TNKIKIGHVHMSGCTGCLVSLADNNLGLIKILDDYADLVYCLTLADVRHI
PEMDVALVEGSVCLQDHESVEDIKETRKKSKIVVALGSCACYGNITRFSR
GGQHNQPQHESYLPIGDLIDVDVYIPGCPPSPELIRNVAVMAYLLLEGNE
EQKELAGKYLKPLMDLAKRGTSGCFCDLMYDVINQGLCMGCGTCAASCPV
HAITLEFGKPQGERDLCIKCGSCYGACPRSFFNLDVISEFENISEIIAKA
LKD

3D structure

PDB

6qgr X-ray Crystallography and Vibrational Spectroscopy Reveal the Key Determinants of Biocatalytic Dihydrogen Cycling by [NiFe] Hydrogenases.

Chain

Resolution

1.839 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.12.98.1: coenzyme F420 hydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	SF4	G	G30 C31 G33 C34 G104 S105 C106 N111 C145	G13 C14 G16 C17 G87 S88 C89 N94 C128
BS02	SF4	G	C191 F192 C215 P216 I220 C234 I235 C237 G238 S239 C240	C174 F175 C198 P199 I203 C217 I218 C220 G221 S222 C223
BS03	SF4	G	V199 C205 M206 G207 C208 G209 T210 C211 P227 C244 P245	V182 C188 M189 G190 C191 G192 T193 C194 P210 C227 P228
BS04	FES	G	C191 C193 R231	C174 C176 R214
BS05	BU3	G	T221 L222	T204 L205
BS06	BU3	G	E258 S261	E241 S244

Gene Ontology

	Molecular Function
GO:0016151	nickel cation binding
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding
GO:0050454	coenzyme F420 hydrogenase activity
GO:0050660	flavin adenine dinucleotide binding
GO:0051536	iron-sulfur cluster binding
GO:0051537	2 iron, 2 sulfur cluster binding
GO:0051539	4 iron, 4 sulfur cluster binding

View graph for
Molecular Function

External links

PDB	RCSB:6qgr, PDBe:6qgr, PDBj:6qgr
PDBsum	6qgr
PubMed	31591784
UniProt	A0A0E3LP72

[Back to BioLiP]