Structure of PDB 6pwe Chain G

Receptor sequence
>6pweG (length=103) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE
LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAV
LLP
3D structure
PDB6pwe Structure of the primed state of the ATPase domain of chromatin remodeling factor ISWI bound to the nucleosome.
ChainG
Resolution3.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R28 R41 V42 G43 A44 T75 R15 R28 V29 G30 A31 T62
BS02 dna G K14 R16 G27 R41 R76 K1 R3 G14 R28 R63
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0007526 larval somatic muscle development
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0005704 polytene chromosome band

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pwe, PDBe:6pwe, PDBj:6pwe
PDBsum6pwe
PubMed31402386
UniProtP84051|H2A_DROME Histone H2A (Gene Name=His2A)

[Back to BioLiP]