Structure of PDB 6ppk Chain G

Receptor sequence
>6ppkG (length=109) Species: 1423 (Bacillus subtilis) [Search protein sequence]
KEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVG
YSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYK
GKGIRYEGE
3D structure
PDB6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
ChainG
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G K60 A64 L65 T68 N75 V93 Y110 S111 H112 K139 E140 R141 G143 Y158 K159 K161 K1 A5 L6 T9 N16 V34 Y51 S52 H53 K80 E81 R82 G84 Y99 K100 K102
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
PDBsum6ppk
PubMed31665744
UniProtP46898|RL6_BACSU Large ribosomal subunit protein uL6 (Gene Name=rplF)

[Back to BioLiP]