Structure of PDB 6p4h Chain G

Receptor sequence

>6p4hG (length=184) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

DIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQ
CPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNA
IINSGPREDSTRIVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIA
ECLADELINAAKGSSNSYAIKKKDELERVAKSNR

3D structure

PDB

6p4h The Israeli acute paralysis virus IRES captures host ribosomes by mimicking a ribosomal state with hybrid tRNAs.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	H51 A57 K59 R60 K63 N74 M76 M78 H79 G80 R81 N82 N83 G84 K86 M88 R145 N148 W152 R159 F163 R164 N165 I166 T168 I169	H36 A42 K44 R45 K48 N59 M61 M63 H64 G65 R66 N67 N68 G69 K71 M73 R125 N128 W132 R139 F143 R144 N145 I146 T148 I149
BS02	rna	G	L103 R135 K182 N186 E195 R198 V199 S202	L88 R115 K162 N166 E175 R178 V179 S182

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6p4h, PDBe:6p4h, PDBj:6p4h
PDBsum	6p4h
PubMed	31609474
UniProt	G1TFM5\|RS5_RABIT Small ribosomal subunit protein uS7 (Gene Name=RPS5)

[Back to BioLiP]