Structure of PDB 6lc1 Chain G

Receptor sequence

>6lc1G (length=86) Species: 9606 (Homo sapiens)

RCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRR
RNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPS

3D structure

• PDB: 6lc1 Structural basis of NR4A1 bound to the human pituitary proopiomelanocortin gene promoter.
• Chain: G
• Resolution: 3.12 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	G	E285 G286 F290 R293 R316 N317 R323 R345 G347 R348 S351	E20 G21 F25 R28 R51 N52 R58 R80 G82 R83 S86	PDBbind-CN: Kd=135.33nM
BS02	dna	G	C276 Q277 H278 Y279 K288 K292 R338 R345 R346 R348	C11 Q12 H13 Y14 K23 K27 R73 R80 R81 R83	PDBbind-CN: Kd=135.33nM
BS03	dna	G	D340 S341	D75 S76	PDBbind-CN: Kd=135.33nM
BS04	ZN	G	C267 C270 C284	C2 C5 C19
BS05	ZN	G	C303 C309 C319 C322	C38 C44 C54 C57

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:6lc1, PDBe:6lc1, PDBj:6lc1
• PDBsum: 6lc1
• PubMed: 31822342
• UniProt: P22736|NR4A1_HUMAN Nuclear receptor subfamily 4immunitygroup A member 1 (Gene Name=NR4A1)