Structure of PDB 6k8k Chain G

Receptor sequence

>6k8kG (length=490) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGR
ASRWWMKQSLAHLSQSLKALGSDLTLIQTHNTISAILDCIRVTGPTKVVF
NHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTS
FNSYWKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEK
PSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPY
LHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYI
CFNFPSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMH
NRIRVIVSSFGVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIP
DGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTV
LKASGVELGTNYAKPIVDIDTARELLAKAISRTREAQIMI

3D structure

PDB

6k8k Structural insights into BIC-mediated inactivation of Arabidopsis cryptochrome 2.

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G290 L293 W321 N356 W374 W397
Catalytic site (residue number reindexed from 1)	G290 L293 W316 N351 W369 W392
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FAD	G	Y232 T244 S245 L246 S248 G290 I291 L293 R294 W353 N356 R359 D387 A388 D389 C392 D393 G396	Y232 T244 S245 L246 S248 G290 I291 L293 R294 W348 N351 R354 D382 A383 D384 C387 D388 G391
BS02	AMP	G	K237 L293 N356 L395 Y399 I404	K237 L293 N351 L390 Y394 I399
BS03	MG	G	T244 H355 N356	T244 H350 N351

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0009881	photoreceptor activity
GO:0009882	blue light photoreceptor activity
GO:0016301	kinase activity
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0071949	FAD binding
GO:0097159	organic cyclic compound binding

	Biological Process
GO:0006139	nucleobase-containing compound metabolic process
GO:0006325	chromatin organization
GO:0006338	chromatin remodeling
GO:0006950	response to stress
GO:0006952	defense response
GO:0007623	circadian rhythm
GO:0009414	response to water deprivation
GO:0009416	response to light stimulus
GO:0009637	response to blue light
GO:0009638	phototropism
GO:0009646	response to absence of light
GO:0009785	blue light signaling pathway
GO:0009909	regulation of flower development
GO:0009911	positive regulation of flower development
GO:0010075	regulation of meristem growth
GO:0010118	stomatal movement
GO:0010244	response to low fluence blue light stimulus by blue low-fluence system
GO:0010617	circadian regulation of calcium ion oscillation
GO:0042752	regulation of circadian rhythm
GO:0046777	protein autophosphorylation
GO:0048574	long-day photoperiodism, flowering
GO:0051607	defense response to virus
GO:0072387	flavin adenine dinucleotide metabolic process
GO:1901371	regulation of leaf morphogenesis
GO:1902347	response to strigolactone
GO:2000028	regulation of photoperiodism, flowering
GO:2000379	positive regulation of reactive oxygen species metabolic process

	Cellular Component
GO:0000325	plant-type vacuole
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0016604	nuclear body
GO:0016605	PML body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6k8k, PDBe:6k8k, PDBj:6k8k
PDBsum	6k8k
PubMed	32398826
UniProt	Q96524\|CRY2_ARATH Cryptochrome-2 (Gene Name=CRY2)

[Back to BioLiP]