Structure of PDB 6k1k Chain G

Receptor sequence
>6k1kG (length=114) Species: 9606 (Homo sapiens) [Search protein sequence]
KARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYL
TAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVL
PNIQAVLLPKKTSA
3D structure
PDB6k1k PARP1 exhibits enhanced association and catalytic efficiency with gamma H2A.X-nucleosome.
ChainG
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R29 R42 V43 G44 K75 T76 R77 R21 R34 V35 G36 K67 T68 R69
BS02 dna G R11 K15 S16 R17 R20 G28 R32 R77 R3 K7 S8 R9 R12 G20 R24 R69
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0042393 histone binding
GO:0046982 protein heterodimerization activity
GO:0140463 chromatin-protein adaptor activity
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006310 DNA recombination
GO:0006334 nucleosome assembly
GO:0006974 DNA damage response
GO:0007283 spermatogenesis
GO:0010212 response to ionizing radiation
GO:0021987 cerebral cortex development
GO:0031507 heterochromatin formation
GO:0045739 positive regulation of DNA repair
GO:0051321 meiotic cell cycle
GO:0071480 cellular response to gamma radiation
GO:0090398 cellular senescence
GO:1990166 protein localization to site of double-strand break
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0000794 condensed nuclear chromosome
GO:0001673 male germ cell nucleus
GO:0001741 XY body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005694 chromosome
GO:0005813 centrosome
GO:0016607 nuclear speck
GO:0035861 site of double-strand break
GO:0070062 extracellular exosome
GO:0090734 site of DNA damage

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k1k, PDBe:6k1k, PDBj:6k1k
PDBsum6k1k
PubMed31848352
UniProtP16104|H2AX_HUMAN Histone H2AX (Gene Name=H2AX)

[Back to BioLiP]