Structure of PDB 6k0b Chain G

Receptor sequence
>6k0bG (length=120) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence]
KKFLEKKLKKIAYERIDILMSLAEEEAKKGNWDRAKRYVYLARRIAMKMR
IRFPKKWKRRICKKCGTFLLYGRNARVRIKSKRYPHVVITCLECGAIYRI
PMIREKKEKRRKKLEERLKA
3D structure
PDB6k0b Cryo-electron microscopy structure of an archaeal ribonuclease P holoenzyme.
ChainG
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G K8 K10 M48 K49 R51 K7 K9 M47 K48 R50
BS02 rna G R51 R53 K59 R60 K64 R77 R79 K81 S82 K83 R84 Y85 V89 I98 R100 P102 R105 K107 K110 R111 R112 K114 R118 R50 R52 K58 R59 K63 R76 R78 K80 S81 K82 R83 Y84 V88 I97 R99 P101 R104 K106 K109 R110 R111 K113 R117
BS03 ZN G C66 C95 C65 C94
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0004526 ribonuclease P activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006396 RNA processing
GO:0008033 tRNA processing
Cellular Component
GO:0005737 cytoplasm
GO:0030677 ribonuclease P complex
GO:1902555 endoribonuclease complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k0b, PDBe:6k0b, PDBj:6k0b
PDBsum6k0b
PubMed31197137
UniProtQ58372|RNP4_METJA Ribonuclease P protein component 4 (Gene Name=rnp4)

[Back to BioLiP]