Structure of PDB 6k0a Chain G

Receptor sequence
>6k0aG (length=119) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence]
KFLEKKLKKIAYERIDILMSLAEEEAKKGNWDRAKRYVYLARRIAMKMRI
RFPKKWKRRICKKCGTFLLYGRNARVRIKSKRYPHVVITCLECGAIYRIP
MIREKKEKRRKKLEERLKA
3D structure
PDB6k0a Cryo-electron microscopy structure of an archaeal ribonuclease P holoenzyme.
ChainG
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G R51 K59 R77 R79 K81 S82 K83 R84 P86 H87 V89 I98 R100 I101 R105 K107 K110 R111 R112 K114 L115 R118 R49 K57 R75 R77 K79 S80 K81 R82 P84 H85 V87 I96 R98 I99 R103 K105 K108 R109 R110 K112 L113 R116
BS02 ZN G C63 C92 C61 C90
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0004526 ribonuclease P activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006396 RNA processing
GO:0008033 tRNA processing
Cellular Component
GO:0005737 cytoplasm
GO:0030677 ribonuclease P complex
GO:1902555 endoribonuclease complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k0a, PDBe:6k0a, PDBj:6k0a
PDBsum6k0a
PubMed31197137
UniProtQ58372|RNP4_METJA Ribonuclease P protein component 4 (Gene Name=rnp4)

[Back to BioLiP]