Structure of PDB 6jo6 Chain G

Receptor sequence
>6jo6G (length=68) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
LDPQIVISGSTAAFLAIGRFVFLGYQRREANIFATNDPAGFNIIDVAGWG
ALGHAVGFAVLAINSLQG
3D structure
PDB6jo6 Structure of the green algal photosystem I supercomplex with a decameric light-harvesting complex I.
ChainG
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G A116 L120 A62 L66
BS02 CLA G Q35 I38 S39 T42 A43 H108 F112 Q4 I7 S8 T11 A12 H54 F58
BS03 CLA G R50 T89 N90 D91 P92 F95 I97 R19 T35 N36 D37 P38 F41 I43
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jo6, PDBe:6jo6, PDBj:6jo6
PDBsum6jo6
PubMed31182847
UniProtP14224|PSAG_CHLRE Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]