Structure of PDB 6jbk Chain G

Receptor sequence

>6jbkG (length=353) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGSYVGDEAQSKRGILTLKY
PIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGY
ALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYV
ALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGM
ESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITA
LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSI
VHR

3D structure

PDB

6jbk Design of an actin-severing peptide

Chain

Resolution

2.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	G	A22 G23 D24 D25 R28 Y143 T148 E167 E334 I341 I345 T351	A18 G19 D20 D21 R24 Y124 T129 E148 E315 I322 I326 T332
BS02	ATP	G	G13 S14 G15 L16 K18 G156 D157 G158 V159 R210 K213 E214 G302 M305 Y306 K336	G9 S10 G11 L12 K14 G137 D138 G139 V140 R191 K194 E195 G283 M286 Y287 K317
BS03	CA	G	D286 D288	D267 D269

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003785	actin monomer binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005523	tropomyosin binding
GO:0005524	ATP binding
GO:0016787	hydrolase activity
GO:0019904	protein domain specific binding
GO:0031013	troponin I binding
GO:0031432	titin binding
GO:0032036	myosin heavy chain binding
GO:0042802	identical protein binding
GO:0048306	calcium-dependent protein binding
GO:0140660	cytoskeletal motor activator activity

	Biological Process
GO:0010628	positive regulation of gene expression
GO:0030041	actin filament polymerization
GO:0030240	skeletal muscle thin filament assembly
GO:0048741	skeletal muscle fiber development
GO:0051017	actin filament bundle assembly
GO:0090131	mesenchyme migration

	Cellular Component
GO:0001725	stress fiber
GO:0005737	cytoplasm
GO:0005856	cytoskeleton
GO:0005865	striated muscle thin filament
GO:0005884	actin filament
GO:0030027	lamellipodium
GO:0030175	filopodium
GO:0031941	filamentous actin
GO:0032432	actin filament bundle
GO:0044297	cell body
GO:0098723	skeletal muscle myofibril

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6jbk, PDBe:6jbk, PDBj:6jbk
PDBsum	6jbk
PubMed
UniProt	P68135\|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]