Structure of PDB 6hk5 Chain G |
>6hk5G (length=66) Species: 1085 (Rhodospirillum rubrum) [Search protein sequence] |
ESPERGRKRLGIYLAHFLDHVEGHMGEIGVQRDALAEDARLGALIDRALA DMAVARASLNAVLRDL |
|
PDB | 6hk5 The carbon monoxide dehydrogenase accessory protein CooJ is a histidine-rich multidomain dimer containing an unexpected Ni(II)-binding site. |
Chain | G |
Resolution | 2.042 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NI |
G |
H18 H22 |
H16 H20 |
|
|
|