Structure of PDB 6gvw Chain G

Receptor sequence
>6gvwG (length=262) Species: 10090 (Mus musculus) [Search protein sequence]
AVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIIRIVHIHSVII
LRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITV
WPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQ
KSSEYERIEIPIHIVPHITIGKVCLESAVELPKILCQEEQDAYRRIHSLT
HLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQE
KEELMEELSSLE
3D structure
PDB6gvw Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
ChainG
Resolution3.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.19.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN G H122 H124 D135 H93 H95 D106
Gene Ontology
Molecular Function
GO:0004843 cysteine-type deubiquitinase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008237 metallopeptidase activity
GO:0030234 enzyme regulator activity
GO:0031593 polyubiquitin modification-dependent protein binding
GO:0046872 metal ion binding
GO:0140492 metal-dependent deubiquitinase activity
Biological Process
GO:0006281 DNA repair
GO:0006282 regulation of DNA repair
GO:0006302 double-strand break repair
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006508 proteolysis
GO:0007095 mitotic G2 DNA damage checkpoint signaling
GO:0010165 response to X-ray
GO:0010212 response to ionizing radiation
GO:0044818 mitotic G2/M transition checkpoint
GO:0045739 positive regulation of DNA repair
GO:0051301 cell division
GO:0070536 protein K63-linked deubiquitination
GO:0071479 cellular response to ionizing radiation
GO:0140861 DNA repair-dependent chromatin remodeling
GO:1900227 positive regulation of NLRP3 inflammasome complex assembly
GO:2000001 regulation of DNA damage checkpoint
Cellular Component
GO:0000151 ubiquitin ligase complex
GO:0000152 nuclear ubiquitin ligase complex
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0070531 BRCA1-A complex
GO:0070552 BRISC complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gvw, PDBe:6gvw, PDBj:6gvw
PDBsum6gvw
PubMed31253574
UniProtP46737|BRCC3_MOUSE Lys-63-specific deubiquitinase BRCC36 (Gene Name=Brcc3)

[Back to BioLiP]