Structure of PDB 6fyy Chain G

Receptor sequence

>6fyyG (length=230) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

MKLNISYPINGTQKCIEIDDEHRVRVFYDKRIGQEVDGESVGDEFKGYVF
KIAGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRNGERKRKSVRGA
IVGPDLAVLALIITKKGEQEIEGITNDTVPKRLGPKRANNIRKFFGLTKE
DDVRDYVIRREVTKGDKSYTKAPKIQRLVTPQRLQRKRQQKSLKIKNAQA
QREAAAEYAQLLAKRLSERKAEKAEVRKRR

3D structure

• PDB: 6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
• Chain: G
• Resolution: 3.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K2 N4 S6 P8 Q13 C15 R31 A53 N56 K58 Q59 G60 F61 P62 Q65 G66 V67 R72 K74 L75 L76 H81 C83 Y84 R85 R87 R88 N89 G90 E91 R92 R94 K95 V108 I112 K131 R132 L133 G134 P135 K136 R137 N139 N140 K143 K149 R154 R159 R160 K164 Y169 A172 P173 K174 I175 Q176 R177 V179 Q182 R183 L184 Q185 R186 K187 R188 Q189 Q190 S192 K194 A198 Q201 R202 L216 R219 K220	K2 N4 S6 P8 Q13 C15 R31 A53 N56 K58 Q59 G60 F61 P62 Q65 G66 V67 R72 K74 L75 L76 H81 C83 Y84 R85 R87 R88 N89 G90 E91 R92 R94 K95 V108 I112 K131 R132 L133 G134 P135 K136 R137 N139 N140 K143 K149 R154 R159 R160 K164 Y169 A172 P173 K174 I175 Q176 R177 V179 Q182 R183 L184 Q185 R186 K187 R188 Q189 Q190 S192 K194 A198 Q201 R202 L216 R219 K220

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
• PDBsum: 6fyy
• PubMed: 30475211
• UniProt: Q6CM04|RS6_KLULA Small ribosomal subunit protein eS6 (Gene Name=RPS6)