Structure of PDB 6ef8 Chain G

Receptor sequence

>6ef8G (length=407) Species: 243231 (Geobacter sulfurreducens PCA)

FHSGGVAECEGCHTMHNSLGGAVMNSATAQFTTGPMLLQGATQSSSCLNC
HQHAGDTGPSSYHISTAEADMPAGTAPLQMTPGGDFGWVKKTYTWNVRGL
NTSEGERKGHNIVAGDYNYVADTTLTTAPGGTYPANQLHCSSCHDPHGKY
RRFVDGSIATTGLPIKNSGSYQNSNDPTAWGAVGAYRILGGTGYQPKSLS
GSYAFANQVPAAVAPSTYNRTEATTQTRVAYGQGMSEWCANCHTDIHNSA
YPTNLRHPAGNGAKFGATIAGLYNSYKKSGDLTGTQASAYLSLAPFEEGT
ADYTVLKGHAKIDDTALTGADATSNVNCLSCHRAHASGFDSMTRFNLAYE
FTTIADASGNSIYGTDPNTSSLQGRSVNEMTAAYYGRTADKFAPYQRALC
NKCHAKD

3D structure

• PDB: 6ef8 Structure of Microbial Nanowires Reveals Stacked Hemes that Transport Electrons over Micrometers.
• Chain: G
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	G	N401 H404 K406	N401 H404 K406
BS02	HEC	G	P129 H243 I246 H257 C328 C331 H332	P129 H243 I246 H257 C328 C331 H332
BS03	HEC	G	E106 R107 H110 N111 D122 L125 A128 Y133 P134 L138 W238 C239 C242 H243 L329 H332 M342	E106 R107 H110 N111 D122 L125 A128 Y133 P134 L138 W238 C239 C242 H243 L329 H332 M342
BS04	HEC	G	F1 H2 C12 C47 C50 H51 Y62 H144 S168 S170 Y171 R187	F1 H2 C12 C47 C50 H51 Y62 H144 S168 S170 Y171 R187
BS05	HEC	G	L48 H51 I64 P82 F86 H110 I112 C140 C143 H144 Y186 R187 L189 Y218 Y231 H335	L48 H51 I64 P82 F86 H110 I112 C140 C143 H144 Y186 R187 L189 Y218 Y231 H335
BS06	HEC	G	C9 C12 H13 L38 Q43 P146 H147 P196 K197 S198	C9 C12 H13 L38 Q43 P146 H147 P196 K197 S198
BS07	HEC	G	Y251 H257 F265 I269 C400 C403 H404	Y251 H257 F265 I269 C400 C403 H404

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0009279 cell outer membrane
• GO:0009986 cell surface

External links

• PDB: RCSB:6ef8, PDBe:6ef8, PDBj:6ef8
• PDBsum: 6ef8
• PubMed: 30951668
• UniProt: Q74A86|OMCS_GEOSL C-type cytochrome OmcS (Gene Name=omcS)