Structure of PDB 6e47 Chain G |
>6e47G (length=112) Species: 10090 (Mus musculus) [Search protein sequence] |
EDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVET DASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPM FKVTVNIGPVPT |
|
PDB | 6e47 Structural basis for murine norovirus engagement of bile acids and the CD300lf receptor. |
Chain | G |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
G |
K94 G96 D98 |
K94 G96 D98 |
|
|
|