Structure of PDB 6dzt Chain G

Receptor sequence
>6dztG (length=106) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQA
VLLPKK
3D structure
PDB6dzt Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
ChainG
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R29 R42 V43 G44 A45 T76 R77 R16 R29 V30 G31 A32 T63 R64
BS02 dna G K15 R17 R32 R77 K2 R4 R19 R64
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0007526 larval somatic muscle development
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0005704 polytene chromosome band

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dzt, PDBe:6dzt, PDBj:6dzt
PDBsum6dzt
PubMed31127102
UniProtP84051|H2A_DROME Histone H2A (Gene Name=His2A)

[Back to BioLiP]