Structure of PDB 6dyj Chain G |
>6dyjG (length=106) Species: 562 (Escherichia coli) [Search protein sequence] |
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED KSPDSPEMWDFRHGFDHLVYHIDDALKLANEGKVKEAQAAAEQLKCHRNA AIQKYL |
|
PDB | 6dyj An efficient, step-economical strategy for the design of functional metalloproteins. |
Chain | G |
Resolution | 1.96 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
G |
H67 H71 H97 |
H67 H71 H97 |
|
|
|
|