Structure of PDB 6bk8 Chain G

Receptor sequence

>6bk8G (length=255) Species: 559292 (Saccharomyces cerevisiae S288C)

SWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSPFA
LQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKL
ALRTEVLDCFGREKFADYREDMGGIGSFRKKNKTLYVGGIDGALNSKHLK
PAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQ
TLLLPSDKEWDDRREGTGLLVKWANEDPDPAAQKRLQEELKLESLNMMVH
LINNN

3D structure

• PDB: 6bk8 Structure of the yeast spliceosomal postcatalytic P complex.
• Chain: G
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	P19 Y34 K36 S38 F47 S49 C73 F75 M80 C82 Y89 F112 F117 D119 Y120 R121 I127 K196 N201 L222 V223	P17 Y32 K34 S36 F45 S47 C71 F73 M78 C80 Y87 F110 F115 D117 Y118 R119 I125 K194 N199 L220 V221
BS02	rna	G	M124 Y138 K179 N180 F183 L222 W225 N227 D229	M122 Y136 K177 N178 F181 L220 W223 N225 D227
BS03	ZN	G	C73 C87 H91	C71 C85 H89

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0017070 U6 snRNA binding
• GO:0036002 pre-mRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000387 spliceosomal snRNP assembly
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0033120 positive regulation of RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome
• GO:0045787 positive regulation of cell cycle

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:6bk8, PDBe:6bk8, PDBj:6bk8
• PDBsum: 6bk8
• PubMed: 29146870
• UniProt: Q12046|CWC2_YEAST Pre-mRNA-splicing factor CWC2 (Gene Name=CWC2)