Structure of PDB 6b6h Chain G

Receptor sequence

>6b6hG (length=201) Species: 83334 (Escherichia coli O157:H7)

PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKE
MILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQV
NPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMT
HPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
R

3D structure

• PDB: 6b6h Structural basis of bacterial transcription activation.
• Chain: G
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	G	T168 R169 Q170 R180 E181 R185	T160 R161 Q162 R172 E173 R177
BS02	dna	G	V139 H199 K201	V131 H191 K193
BS03	CMP	G	V49 L61 G71 L73 R82 S83 A84 V86 R123	V41 L53 G63 L65 R74 S75 A76 V78 R115

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003680 minor groove of adenine-thymine-rich DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0008301 DNA binding, bending
• GO:0030552 cAMP binding
• GO:0042802 identical protein binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0045013 carbon catabolite repression of transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:6b6h, PDBe:6b6h, PDBj:6b6h
• PDBsum: 6b6h
• PubMed: 29146813
• UniProt: P0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)