Structure of PDB 6ahr Chain G

Receptor sequence
>6ahrG (length=131) Species: 9606 (Homo sapiens) [Search protein sequence]
GAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDG
GARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELV
DELEPETDTREPLTRIRNNSAIHIRVFRVTP
3D structure
PDB6ahr Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
ChainG
Resolution3.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G T21 L22 R23 R32 Y38 V39 N40 M41 T43 F45 K46 A47 L49 A50 R51 Q53 R61 G62 Q63 L74 L76 Q87 G91 V105 L107 R125 N126 T13 L14 R15 R24 Y30 V31 N32 M33 T35 F37 K38 A39 L41 A42 R43 Q45 R53 G54 Q55 L66 L68 Q79 G83 V97 L99 R117 N118
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0033204 ribonuclease P RNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0008033 tRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005655 nucleolar ribonuclease P complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030681 multimeric ribonuclease P complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ahr, PDBe:6ahr, PDBj:6ahr
PDBsum6ahr
PubMed30454648
UniProtO75817|POP7_HUMAN Ribonuclease P protein subunit p20 (Gene Name=POP7)

[Back to BioLiP]