Structure of PDB 5we0 Chain G

Receptor sequence

>5we0G (length=218) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]

SNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHE
KMPIFMDIAFIEYCFNLSLDPSQQILWEYSLISNALERLENIELERQNCM
RELLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDW
GEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQL
EVFCDYDFKQREIVKMLT

3D structure

PDB

5we0 Structural Basis for Shelterin Bridge Assembly.

Chain

Resolution

2.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	G	F18 Y24 M26 N35 L38 R39 L41 G42 Y43 M47 C48 H49 M52 F60 Y63 C64 Q88 I89 L95 N98 R102	F18 Y24 M26 N35 L38 R39 L41 G42 Y43 M47 C48 H49 M52 F60 Y63 C64 Q74 I75 L81 N84 R88
BS02	peptide	G	T132 E136 L140 C143 R150 E181 Y199 F212 R218 Q221 C222 L225	T108 E112 L116 C119 R126 E154 Y172 F185 R191 Q194 C195 L198

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0000723	telomere maintenance
GO:0016233	telomere capping
GO:0032200	telomere organization

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0070187	shelterin complex
GO:0140445	chromosome, telomeric repeat region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5we0, PDBe:5we0, PDBj:5we0
PDBsum	5we0
PubMed	29149597
UniProt	O13852\|POZ1_SCHPO Protection of telomeres protein poz1 (Gene Name=poz1)

[Back to BioLiP]