Structure of PDB 5uym Chain G

Receptor sequence

>5uymG (length=151) Species: 83333 (Escherichia coli K-12)

PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
A

3D structure

• PDB: 5uym Ensemble cryo-EM elucidates the mechanism of translation fidelity
• Chain: G
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	P1 R2 R3 R9 K24 N27 M30 D32 G33 K34 K35 S36 T37 I41 R77 R78 R94 R101 R108 K113 S114 M115	P1 R2 R3 R9 K24 N27 M30 D32 G33 K34 K35 S36 T37 I41 R77 R78 R94 R101 R108 K113 S114 M115
BS02	rna	G	S76 Q85 K135 R142 M143 A146	S76 Q85 K135 R142 M143 A146
BS03	rna	G	V79 G80 G81	V79 G80 G81

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0015935 small ribosomal subunit

External links

• PDB: RCSB:5uym, PDBe:5uym, PDBj:5uym
• PDBsum: 5uym
• PubMed: 28538735
• UniProt: P02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)