Structure of PDB 5umd Chain G

Receptor sequence

>5umdG (length=124) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

VMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRKISCFV
TVRGKKALEILEKGLKRRKNFSDTGNFGFGIGMDFYVHLSRSGYRVTRRT
RRRSKISKTHKVTKEDAMKWFQTK

3D structure

PDB

5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K16 V18 N20 C22 R51 S66 F68 N95 S97 D98 T99 G103 F104 G105 I106 G124 D126 Y128 H130 Y136 R140 T142 K147 K153	K9 V11 N13 C15 R44 S47 F49 N70 S72 D73 T74 G78 F79 G80 I81 G82 D84 Y86 H88 Y94 R98 T100 K105 K111
BS02	rna	G	M9 Q43 K44 I46 T70 R72 G135 R137 V138 R141 T142 R144 S146 S149 K150 T151 H152	M2 Q36 K37 I39 T51 R53 G93 R95 V96 R99 T100 R102 S104 S107 K108 T109 H110

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links