Structure of PDB 5ten Chain G

Receptor sequence

>5tenG (length=269) Species: 216895 (Vibrio vulnificus CMCP6)

MVRIAVAGAAGRMGRNLVKAAHHNPVAKVAAGSERPESSLVGVDLGELCG
EGKFDVVVCDDLAKQIDQFDVIIDFTAPASTLNNLALCQQYGKSIVIGTT
GFTEEQREQIDLVAQQVPVVMAPNYSVGVNLVFKLLEKAAKVMGDYCDIE
IVEAHHRHKVDAPSGTAIGMGEAIAGAMGNKLSDVAVYAREGITGERTKD
EIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTFANGAVKAAVWL
HEKPAGFYTMTDVLGLNDL

3D structure

• PDB: 5ten Comparative structural and mechanistic studies of 4-hydroxy-tetrahydrodipicolinate reductases from Mycobacterium tuberculosis and Vibrio vulnificus.
• Chain: G
• Resolution: 2.45 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H155 K159
• Catalytic site (residue number reindexed from 1): H155 K159
• Enzyme Commision number: 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	G	G8 G11 R12 M13 E34 R35 F75 T76 S80 G98 T100 P123 N124 Y125 F239	G8 G11 R12 M13 E34 R35 F75 T76 S80 G98 T100 P123 N124 Y125 F239
BS02	7FN	G	H155 H156 K159 S164 G165 T166	H155 H156 K159 S164 G165 T166

Gene Ontology

Molecular Function

• GO:0008839 4-hydroxy-tetrahydrodipicolinate reductase
• GO:0016491 oxidoreductase activity
• GO:0016726 oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0009085 lysine biosynthetic process
• GO:0009089 lysine biosynthetic process via diaminopimelate
• GO:0019877 diaminopimelate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5ten, PDBe:5ten, PDBj:5ten
• PDBsum: 5ten
• PubMed: 32980502
• UniProt: Q8DEM0|DAPB_VIBVU 4-hydroxy-tetrahydrodipicolinate reductase (Gene Name=dapB)