Structure of PDB 5t9b Chain G

Receptor sequence

>5t9bG (length=259) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

NLLSPDRILTVAHRGASGYVPEHTILSYETAQKMKADFIELDLQMTKDGK
LIVMHDEKLDRTTNGMGWVKDHTLADIKKLDAGSWFNEAYPEKAKPQYVG
LKVPTLEEVLDRFGKHANYYIETKSPDTYPGMEEKLIASLQKHKLLKPGQ
VIIQSFSKESLVKVHQLQPNLPTVQLLEAKQMASMTDAALEEIKTYAVGA
GPDYKALNQENVRMIRSHGLLLHPYTVNNEADMHRLLDWGVTGVFTNYPD
LFHKVKKGY

3D structure

• PDB: 5t9b Identification of Two Phosphate Starvation-induced Wall Teichoic Acid Hydrolases Provides First Insights into the Degradative Pathway of a Key Bacterial Cell Wall Component.
• Chain: G
• Resolution: 1.62 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E70 D72 E152
• Catalytic site (residue number reindexed from 1): E40 D42 E122
• Enzyme Commision number: 3.1.4.46: glycerophosphodiester phosphodiesterase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	G	E70 D72 E152	E40 D42 E122
BS02	G3P	G	H43 R44 E70 H85 Q188 Y259 F279	H13 R14 E40 H55 Q154 Y225 F245

Gene Ontology

Molecular Function

• GO:0008081 phosphoric diester hydrolase activity
• GO:0008889 glycerophosphodiester phosphodiesterase activity
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006071 glycerol metabolic process
• GO:0006629 lipid metabolic process
• GO:0071555 cell wall organization

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:5t9b, PDBe:5t9b, PDBj:5t9b
• PDBsum: 5t9b
• PubMed: 27780866
• UniProt: P37965|GLPQ_BACSU Glycerophosphodiester phosphodiesterase (Gene Name=glpQ)