Structure of PDB 5t6r Chain G

Receptor sequence

>5t6rG (length=296) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

5t6r Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis.

Chain

Resolution

4.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K8 R15 F16 Q17 P19 R23 T28 D29 R35 K48 R140 P141 F142 F145 L146 R152 T153 H175 S176 N178 R179	K7 R14 F15 Q16 P18 R22 T27 D28 R34 K47 R139 P140 F141 F144 L145 R151 T152 H174 S175 N177 R178
BS02	rna	G	K8 S10 S13 S14 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 N57 K58 I65 I69 T70 D72 G91 N94 W95 Q151 R152 T155 A157 R158 Y198 H203 V204 Y207 R218 L222 K224 Y265 A266 S269 Y272 Q274 K276 L277 K279 R285 V286 K289	K7 S9 S12 S13 T17 F19 R20 R21 R23 K26 T27 Y29 R32 R49 R53 N56 K57 I64 I68 T69 D71 G90 N93 W94 Q150 R151 T154 A156 R157 Y197 H202 V203 Y206 R217 L221 K223 Y264 A265 S268 Y271 Q273 K275 L276 K278 R284 V285 K288

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5t6r, PDBe:5t6r, PDBj:5t6r
PDBsum	5t6r
PubMed	28179369
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]