Structure of PDB 5n9g Chain G

Receptor sequence

>5n9gG (length=178) Species: 9606 (Homo sapiens) [Search protein sequence]

GPSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIRE
PRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQ
NMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFV
SGKVVLTGAKVRAEIYEAFENIYPILKG

3D structure

PDB

5n9g Molecular mechanisms of Bdp1 in TFIIIB assembly and RNA polymerase III transcription initiation.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	G	Q166 N167 R196 F197 I201 R203 T210 L212 T222 G223 V259 P289 F305 S307 K309 V311	Q10 N11 R40 F41 I45 R47 T54 L56 T66 G67 V103 P133 F149 S151 K153 V155
BS02	rna	G	V169 T171 F214 S216 K218 V220 Q256 N257 F288 R294 V301 L303 T313	V13 T15 F58 S60 K62 V64 Q100 N101 F132 R138 V145 L147 T157

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5n9g, PDBe:5n9g, PDBj:5n9g
PDBsum	5n9g
PubMed	28743884
UniProt	P20226\|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]