Structure of PDB 5lmv Chain G

Receptor sequence

>5lmvG (length=155) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW

3D structure

PDB

5lmv Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.

Chain

Resolution

4.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	A2 R3 R4 R6 A7 R10 N28 K29 I30 M31 R32 D33 G34 K35 L38 I42 R76 R78 G81 R94 R95 S98 R102 R114 R115 A116 R119 W156	A1 R2 R3 R5 A6 R9 N27 K28 I29 M30 R31 D32 G33 K34 L37 I41 R75 R77 G80 R93 R94 S97 R101 R113 R114 A115 R118 W155
BS02	rna	G	R79 V80 G81 G82	R78 V79 G80 G81

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lmv, PDBe:5lmv, PDBj:5lmv
PDBsum	5lmv
PubMed	27662086
UniProt	P17291\|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]