Structure of PDB 5l8r Chain G

Receptor sequence
>5l8rG (length=97) Species: 3888 (Pisum sativum) [Search protein sequence]
LNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDTR
AKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKF
3D structure
PDB5l8r Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
ChainG
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G R107 Y111 R50 Y54
BS02 CLA G I137 N148 I80 N91
BS03 CLA G F79 F82 Q83 N86 V87 Q90 F22 F25 Q26 N29 V30 Q33
BS04 CLA G S61 I64 S65 T68 G69 H136 Y140 S4 I7 S8 T11 G12 H79 Y83
BS05 CLA G R76 F77 S117 N118 D119 P120 I125 R19 F20 S60 N61 D62 P63 I68
BS06 CLA G Y141 T145 N148 Y150 P152 Y84 T88 N91 Y93 P95
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l8r, PDBe:5l8r, PDBj:5l8r
PDBsum5l8r
PubMed28248295
UniProtQ9S7N7|PSAG_ARATH Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]