Structure of PDB 5kgf Chain G

Receptor sequence
>5kgfG (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]
KARARAKSRSSRAGLQFPVGRVHRLLRRGNYAERVGAGAPVYLAAVLEYL
TAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVL
PNIQAVLLPKKTE
3D structure
PDB5kgf The structural basis of modified nucleosome recognition by 53BP1.
ChainG
Resolution4.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R29 R35 R42 V43 A45 T76 R77 R21 R27 R34 V35 A37 T68 R69
BS02 dna G R11 K15 R17 R20 G28 R29 R32 R77 R3 K7 R9 R12 G20 R21 R24 R69
BS03 peptide G Y57 E61 E64 N89 D90 E92 L93 Y49 E53 E56 N81 D82 E84 L85
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5kgf, PDBe:5kgf, PDBj:5kgf
PDBsum5kgf
PubMed27462807
UniProtP0C0S8|H2A1_HUMAN Histone H2A type 1 (Gene Name=H2AC11)

[Back to BioLiP]